DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and CG13833

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:258 Identity:57/258 - (22%)
Similarity:95/258 - (36%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAALTVGIVITV---RTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRN 82
            :||:|..:::..   |.:.....|.....|..::.||||...|:|..|:..||.:|..|.:...|
  Fly    21 LAAITPLLILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDIN 85

  Fly    83 LEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEAR--------YLDLCSLRSVHHFAGQLM 139
            :...:                   |.....:|.|.|.|:        |.||..|.|      :::
  Fly    86 VSGAE-------------------DTVKQIQDIYKVRAKAYKANVTNYDDLVELNS------KVV 125

  Fly   140 AEFERIDVLVNNAGVVF-ANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAH 203
            .|...:.||||||||:. .|...|.....:....||..:.|....:.||.::...:|.|:.:|:.
  Fly   126 EEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSL 190

  Fly   204 AHQGAKIDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKG-TSVTVNCCTPGLVR 265
            |              |.:.:.:.|......|.....:.|..|..:|:. ..:.|....|..:|
  Fly   191 A--------------GVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 52/229 (23%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 51/226 (23%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 51/226 (23%)
NADB_Rossmann 54..297 CDD:304358 51/225 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.