DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and wwox

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_957207.1 Gene:wwox / 393887 ZFINID:ZDB-GENE-040426-858 Length:412 Species:Danio rerio


Alignment Length:327 Identity:98/327 - (29%)
Similarity:143/327 - (43%) Gaps:63/327 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGC 99
            ::.||      .:.:::::|||.|||||||.|::.|..|..:||||||.....:||::|..|.  
Zfish   113 ILHGQ------DLSDKVIIVTGANSGIGFETARSFALHGAHVILACRNQSRASKAASLIMGEW-- 169

  Fly   100 RTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTE 164
                          .:..||...|||.|||||..||....|....:.|||.||.|.....:: ||
Zfish   170 --------------SKARVEVLPLDLASLRSVRQFAELFKATKLPLHVLVCNAAVCSQPWRL-TE 219

  Fly   165 DGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQ---------GAKIDFDDPLNVGT 220
            ||||...|:.:|..|||..||...|:.|...|::.||:.:|:         ...:|...|.....
Zfish   220 DGFESTFQICHLGHFLLVQLLQDVLRLSAPARVVVVSSESHRFTDLLDSCGNLDLDLLSPPQKNY 284

  Fly   221 WSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVT 285
            ||:.     |:..:|||.||.:..:.|.:....:..|...||               |:...::.
Zfish   285 WSLL-----AYNRAKLCNLLFSSELHRRMSPHGICCNALHPG---------------SMMFTSIH 329

  Fly   286 YPWMWL----------FMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKK 340
            ..| ||          |.|:..:||...:..|..|:|:.:.|.|||:|.....|...||...|..
Zfish   330 RSW-WLLTLLFSLARPFTKSMQQGAATTVYCAVAPELEGIGGMYFNNCFRCLPSPQAQDPAAALS 393

  Fly   341 LY 342
            |:
Zfish   394 LW 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 86/289 (30%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 95/310 (31%)
wwoxNP_957207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 18..47 CDD:278809
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 59..88 CDD:278809
PRK06196 108..402 CDD:235736 98/327 (30%)
human_WWOX_like_SDR_c-like 121..404 CDD:187669 96/313 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.