DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and CG11200

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster


Alignment Length:286 Identity:86/286 - (30%)
Similarity:138/286 - (48%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAII------KRELGCRTPLNSLD 107
            ::|.|:||||.|||..|.:.|......:::..|:.:..:.|.|.|      |.:|.|        
  Fly    67 DRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLIC-------- 123

  Fly   108 EDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQ 172
                         ..||:..|:||..||..:...:.::|:|:||||::||..:: |.||:|.|..
  Fly   124 -------------EQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKL-TADGYESHFA 174

  Fly   173 VNYLAPFLLTHLLLPHL----QRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFAH 233
            :|:|..|||||||||.|    :.....||:.||:..:...:|::.| :| ||  ..::...|::.
  Fly   175 INFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKD-IN-GT--KHYYPGTAYSQ 235

  Fly   234 SKLCVLLATRWMAR--ELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNA 296
            |||..:|.||.:..  :.:.:.|.||...||:| .|..|.:|...|....|.       ||.|..
  Fly   236 SKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIV-DTDLFEHSATTSVPIFKK-------LFFKTP 292

  Fly   297 YEGAQCAIRLATDPQLKEVTGEYFND 322
            ..|::..:..|.||.::...|.|.::
  Fly   293 ERGSRTVVFAAIDPSIEGQGGTYLSN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 84/280 (30%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 86/285 (30%)
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 86/286 (30%)
NADB_Rossmann 67..338 CDD:304358 86/286 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.