DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Rdh11

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001012193.1 Gene:Rdh11 / 362757 RGDID:1312001 Length:316 Species:Rattus norvegicus


Alignment Length:334 Identity:111/334 - (33%)
Similarity:177/334 - (52%) Gaps:41/334 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WWPTIAALT-VGIVIT--VRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIIL 78
            |:|.:.:|. :..::|  :|.::|...|.::.|:..::.:|||.|:|||.|.|:.||.||.|:.|
  Rat     3 WFPLLLSLPFILFLVTPKIRKMLSCGVCTSNVQLSGKVAIVTGANTGIGKETAKDLARRGARVYL 67

  Fly    79 ACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFE 143
            |||:::.|:..|:.|:...|     ||.           |..|.|||...:|:..||...:||.:
  Rat    68 ACRDMQKGELVASEIQATTG-----NSQ-----------VLVRKLDLADTKSIRAFAEGFLAEEK 116

  Fly   144 RIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGA 208
            .:.:|:|||||:.. ....|.||||.|..||:|..||||||||..|:.|...|::.||:.||...
  Rat   117 YLHILINNAGVMMC-PYSKTADGFEMHFGVNHLGHFLLTHLLLEKLKESGPSRVVNVSSLAHHLG 180

  Fly   209 KIDFDDPLNVGTWSVKFHARE-AFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRN 272
            :|.|.:     ....||::.. |:.||||..:|.|:.:||.|||:.||.....||.|.       
  Rat   181 RIHFHN-----LHGEKFYSGGLAYCHSKLANILFTKELARRLKGSRVTTYSVHPGTVH------- 233

  Fly   273 SPLMSSLCVKAVTYPWMW----LFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQ 333
                |.|...:....|:|    .|:|...:|||.::..|....::.::|.:|:||::|..|....
  Rat   234 ----SELIRHSTALKWLWQLFFFFIKTPQQGAQTSLYCAVTEGIEGLSGSHFSDCQLAWVSSQAG 294

  Fly   334 DKELAKKLY 342
            ::.:|::|:
  Rat   295 NETIARRLW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 95/275 (35%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 102/296 (34%)
Rdh11NP_001012193.1 NADB_Rossmann 38..306 CDD:419666 103/299 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.