DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and CG13284

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001260523.1 Gene:CG13284 / 35021 FlyBaseID:FBgn0032614 Length:339 Species:Drosophila melanogaster


Alignment Length:372 Identity:80/372 - (21%)
Similarity:144/372 - (38%) Gaps:84/372 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WPTIAA-------LTVGIVI--TVRTLMSGQRCPNDNQIKE-----------QIVVVTGGNSGIG 62
            |..|:|       ||:|:.:  .:::|:|..:...:...:.           |..||||...|||
  Fly    19 WQLISAAIYLVGLLTIGVFLYDNLKSLVSIIKAVLEPYFQPHLPRTLVDKFGQWAVVTGATDGIG 83

  Fly    63 FEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYL--DL 125
            .|.|:.||.:|..::|..|.    |.....:..|:               |.:|.|:.:::  |.
  Fly    84 KEYARELARQGINLVLISRT----KEKLIAVTNEI---------------ESQYKVKTKWIAADF 129

  Fly   126 CSLRSVHHFAGQLMAEFERIDV--LVNNAGVVFANTQ---MPTEDGFERHSQVNYLAPFLLTHLL 185
            ...|.|:   .|:..|...|||  ||||.|:::.:.:   :.:||.......||..:..:||..:
  Fly   130 AKGREVY---DQIEKELAGIDVGILVNNVGMMYEHPESLDLVSEDLLWNLLTVNMGSVTMLTRKI 191

  Fly   186 LPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELK 250
            ||.:....:|.|:      :.|:..:.....|:          ..:|.||..|...::.:..|:.
  Fly   192 LPQMIGRRKGAIV------NLGSSSELQPLPNM----------TVYAASKKFVTYFSKALELEVA 240

  Fly   251 GTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEV 315
            ..::.|....|..|....:.....:|..           .||..|||..|:.|:  .|..:..|.
  Fly   241 EHNIHVQLVMPNFVVTKMNAYTDRVMQG-----------GLFFPNAYTFARSAV--FTLGKTSET 292

  Fly   316 TGEYFNDCEIAASSV------TGQDKELAKKLYMQTIKTLESVTKLT 356
            .|.:.:..:.|...:      |....:|.|:|.::.::..:...|||
  Fly   293 NGFWTHGIQYAIMKLAPLPIRTYLGHQLFKRLRIEALEQKQKKLKLT 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 63/288 (22%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 68/304 (22%)
CG13284NP_001260523.1 DltE 70..323 CDD:223377 67/303 (22%)
17beta-HSD1_like_SDR_c 70..309 CDD:187614 65/289 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.