DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and firl

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001033900.2 Gene:firl / 34627 FlyBaseID:FBgn0032405 Length:318 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:70/171 - (40%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IKEQIVVVTGGNSGIGFEIAQALAGRGGRIILAC------RNLEAGKRAAAIIKRELGCRTPLNS 105
            :..:||::||...|||.|:|...|..|..::  |      .||:..::|..:            :
  Fly    53 VSGEIVLITGTGHGIGRELALHYASLGSTVV--CVDIDGKNNLQTVEKAKRL------------N 103

  Fly   106 LDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTE------ 164
            |.|         |.:...|:.....|...|.::.::...|.|||||.|:      |||.      
  Fly   104 LGE---------VYSYSCDVSKRDEVTALADRIKSDVGCISVLVNNVGI------MPTHPILQQS 153

  Fly   165 -DGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHA 204
             :..:|...||..:.|......|||:|...:|.|:.:|:.|
  Fly   154 AEEIQRVFDVNVFSQFWTIQAFLPHMQEKCRGHIICMSSIA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 43/171 (25%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 43/168 (26%)
firlNP_001033900.2 adh_short 56..246 CDD:278532 43/168 (26%)
17beta-HSDXI-like_SDR_c 57..299 CDD:187598 43/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.