DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and cbr1l

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_919360.1 Gene:cbr1l / 337696 ZFINID:ZDB-GENE-030131-9642 Length:277 Species:Danio rerio


Alignment Length:305 Identity:80/305 - (26%)
Similarity:119/305 - (39%) Gaps:71/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IKEQIVVVTGGNSGIGFEIAQAL--AGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDED 109
            :.:::.||||.|.|||..|.:.|  ||..|.|:|..||.:.|:.|.|.::.| |.:.        
Zfish     1 MSKKVAVVTGANKGIGLAIVKGLCKAGFTGDILLTARNEKLGQEAIAGLQSE-GFKN-------- 56

  Fly   110 DNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQM-PTEDGFERHSQV 173
                    |....||:|...|.......|..::..:|||:||||:.|.|... |..:..|...:.
Zfish    57 --------VVFHQLDICDQGSCMKLKKFLEEKYGGLDVLINNAGIAFKNAATEPFGEQAEVTMRT 113

  Fly   174 NYLAPFLLTHLLLPHLQRSEQGRILFVSA----------HAHQGAKI---------------DFD 213
            |:.......|.|||.|:.:  .|::.||:          .|...||.               :|.
Zfish   114 NFWGTLWACHALLPILRAN--ARVVNVSSFVSKKSLDQCSAELQAKFRNKDLSEEELCLLMGEFV 176

  Fly   214 DPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELK----GTSVTVNCCTPGLVRGTRHFRNSP 274
            .....|..|.|.....|:..:|:.|.:.:|..||.|.    |..:.:|.|.||.||.......:|
Zfish   177 QDAQAGDHSAKGWPNTAYGTTKIGVTVLSRIQARVLNETRPGDGILLNACCPGWVRTDMAGPKAP 241

  Fly   275 LMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQ-LKEVTGE 318
                               |:..|||:..:.||..|: .||..|:
Zfish   242 -------------------KSPEEGAETPVYLAMLPEGAKEPHGQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 79/303 (26%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 80/302 (26%)
cbr1lNP_919360.1 carb_red_PTCR-like_SDR_c 4..277 CDD:187585 80/302 (26%)
adh_short 4..242 CDD:278532 70/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.