DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and rdh14b

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001040655.1 Gene:rdh14b / 334665 ZFINID:ZDB-GENE-030131-6605 Length:323 Species:Danio rerio


Alignment Length:301 Identity:112/301 - (37%)
Similarity:166/301 - (55%) Gaps:32/301 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDN 111
            ::.:.|:|||.|.|||...|..|.....|:|:|||:.:..:.||..|:.:.|     .|..|   
Zfish    39 MRGKTVIVTGANCGIGKATAAELLKLQARVIMACRDRQRAEDAARDIQNQAG-----TSQGE--- 95

  Fly   112 PEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMP---TEDGFERHSQV 173
                  :..::|||.||:||..|..:::.|..|||||:||||:.    |.|   ||:|||....|
Zfish    96 ------IVIKHLDLASLQSVRRFCEEVIREEPRIDVLINNAGLY----QCPYSKTEEGFEMQLGV 150

  Fly   174 NYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFAHSKLCV 238
            |:|..||||:|||..|::|...|::.||:..::...|:|:|..:..:::..|    .::.|||..
Zfish   151 NHLGHFLLTNLLLDLLKQSSPSRVVVVSSKLYKYGSINFEDLNSEQSYNKSF----CYSQSKLAN 211

  Fly   239 LLATRWMARELKGTSVTVNCCTPGLVRGT--RHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQ 301
            ||.||.:||.|.||.||||..|||:||..  ||. |.||:    :|.:.:...|||.|:..||||
Zfish   212 LLFTRELARRLDGTEVTVNALTPGIVRTRLGRHV-NIPLL----IKPLFWLVSWLFFKSPLEGAQ 271

  Fly   302 CAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
            ..:.||..|:::.|:|:.|.:||.........|...||:|:
Zfish   272 TPLYLACSPEVEGVSGKCFANCEEEQLLSKATDDHAAKRLW 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 104/275 (38%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 111/296 (38%)
rdh14bNP_001040655.1 PRK06197 41..322 CDD:235737 112/299 (37%)
NADB_Rossmann 41..315 CDD:304358 112/299 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.