DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and CG31810

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:308 Identity:67/308 - (21%)
Similarity:119/308 - (38%) Gaps:65/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYF 117
            ||||...|||.|.|:.||.:|..::|..|..|  |..|  :..|:|               .:|.
  Fly    60 VVTGATDGIGKEYARELARQGLNLVLVSRKEE--KLIA--VTNEIG---------------SQYN 105

  Fly   118 VEARYL--DLCSLRSVH-HFAGQLMAEFERIDVLVNNAGVVF--ANTQMPTEDGFERHSQVNYLA 177
            |:.:::  |....|.|: |...:|..  ..:.:||||.|.:.  .:....:||.......||..:
  Fly   106 VKIKWIVADFAKGREVYAHIEKELNG--IEVGILVNNVGTIHDPESLDKVSEDMLWDLLTVNVGS 168

  Fly   178 PFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWS-VKFHAR-EAFAHSKLCVLL 240
            ..:||..:||.:....:|.|                  :|:|:.| ::.|.. .|:|.:|..|..
  Fly   169 VTMLTRKILPQMISRRKGAI------------------VNLGSSSELQPHPNLTAYAATKKFVTH 215

  Fly   241 ATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIR 305
            .|:.:..|:...::.|....|..|....:..:..:...           .|...|||..|:.|: 
  Fly   216 FTKGLEYEVAEHNIHVQLVMPAFVATNMNSYSDKVRQG-----------GLLFPNAYSYARSAV- 268

  Fly   306 LATDPQLKEVTGEYFNDCEIAASSVTGQD------KELAKKLYMQTIK 347
             .|..:..|..|.:.:..:.|...:...|      .:|.|::.::.::
  Fly   269 -FTLGKTSETNGFWVHGLQYAFMKLAPMDIRTYFGYQLFKRMRIEAME 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 62/271 (23%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 67/301 (22%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 67/301 (22%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 64/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447686
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.