DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Ldsdh1

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:79/195 - (40%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WWPTIAALTVGIVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACR 81
            :|..||...||:.          |.|..:.:..::|::||...|:|.|:|               
  Fly    36 FWLAIAEAIVGLF----------RAPPLDDVNGKVVLITGTGHGMGKEMA--------------- 75

  Fly    82 NLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERID 146
             |:..|..|.|:..::..:|...::.|..|...:.|  ....::.....:...|.::..|...|.
  Fly    76 -LQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAF--GYVCNVTKREELIELAQKVRKEHGFIH 137

  Fly   147 VLVNNAGVVFANTQMP-------TEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHA 204
            |:|||||:      ||       ||:......::|.|:.|.:....||.:....:|.|:.:|:.|
  Fly   138 VVVNNAGI------MPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCA 196

  Fly   205  204
              Fly   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 37/165 (22%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 37/162 (23%)
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 37/162 (23%)
NADB_Rossmann 60..287 CDD:304358 37/161 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447662
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.