DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and spidey

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey / 31703 FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster


Alignment Length:326 Identity:79/326 - (24%)
Similarity:124/326 - (38%) Gaps:101/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYF 117
            ||||...|||...|:.||.||.:::|..|:||    ...::.:|:|               |:|.
  Fly    56 VVTGSTDGIGKAYAKELARRGLKLVLISRSLE----KLNVVAKEIG---------------DKYG 101

  Fly   118 VEARYLDLCSLRSVHHFAG--QLMAEFE------RIDVLVNNAGVVFANTQMPTEDGFERHSQVN 174
            ||.|.:|:       .|.|  ::..:..      .:.|||||.|:.:         |...:....
  Fly   102 VEVRVIDV-------DFTGGDEIYDKIREKTTGLNVGVLVNNVGISY---------GHPEYFLDC 150

  Fly   175 YLA--PFL-------------LTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVK 224
            |.|  |||             :|.|.||.:....:|.|:.||:.|  |.   ..:||    .|| 
  Fly   151 YKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVIINVSSTA--GV---IPNPL----LSV- 205

  Fly   225 FHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWM 289
            :.:.:||. :|....|.|     |.|...:.:....||.|        :..||.:...:|..|..
  Fly   206 YSSTKAFV-NKFSDDLQT-----EYKEHGILIQSVQPGFV--------ATNMSKIRKASVFAPSP 256

  Fly   290 WLFMKNAYEGAQCAIRLATDP---------QL-----KEVTGEYFNDCEIAASSVTGQDKELAKK 340
            ..::::|..    .:.:||..         ||     :.|.||.|.. .|...::.|..|...::
  Fly   257 ETYVRSALS----TLGIATQTAGYLPHALLQLVIHFTEAVFGEQFAR-NIVMKNILGTRKRALRR 316

  Fly   341 L 341
            |
  Fly   317 L 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 72/301 (24%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 79/326 (24%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 79/326 (24%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 71/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447535
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.