DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Cbr3

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:321 Identity:83/321 - (25%)
Similarity:125/321 - (38%) Gaps:103/321 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QIVVVTGGNSGIGFEIAQALAGR-GGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPE 113
            ::.:|||.|.||||.|.:.|..: .|.::|..|:...|:.|...::.| |.....:.|| .|||:
  Rat     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAE-GLSPRFHQLD-IDNPQ 68

  Fly   114 DRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAP 178
                         |:|::..|   |..|:..::|||||||:.|   :|.....|:..::|.....
  Rat    69 -------------SIRALRDF---LRKEYGGLNVLVNNAGIAF---RMDDPTPFDVQAEVTLKTN 114

  Fly   179 FLLTH--------LLLPHLQRSEQGRILFVSAHAHQGAKI------DFDDPLNVGTWS------- 222
            |..|.        ::.||      ||::.||  :.||.|.      |..:.....|.:       
  Rat   115 FFATRNVCTELLPIMKPH------GRVVNVS--SLQGLKALENCSEDLQERFRCDTLTEGDLVDL 171

  Fly   223 -VKF--------HARE-----AFAHSKLCVLLATRWMAREL----KGTSVTVNCCTPGLVR---- 265
             .||        |.||     |:..|||.|.:.||.:||:|    |...:.:|.|.||.|:    
  Rat   172 MKKFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMA 236

  Fly   266 ---GTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLA-TDPQLKEVTGEYFND 322
               |:|                          ...|||:..:.|| ..|...|..|:...|
  Rat   237 RDQGSR--------------------------TVEEGAETPVYLALLPPDATEPHGQLVRD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 81/315 (26%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 83/321 (26%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 83/321 (26%)
adh_short 6..241 CDD:278532 72/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.