DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Dhrs13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038943561.1 Gene:Dhrs13 / 303275 RGDID:1305508 Length:375 Species:Rattus norvegicus


Alignment Length:394 Identity:123/394 - (31%)
Similarity:186/394 - (47%) Gaps:60/394 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AALTVG-IVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEA 85
            |.|.:| .|:....|:....|.....::.:..||||.|||||...|..||.||.|::||||:.|.
  Rat     8 AGLLLGAYVLVYYNLVKAPPCGGIGSLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSRER 72

  Fly    86 GKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVN 150
            |:.||..:::|.|            |.|..:..    |||.||.||..||...::...|:|:|::
  Rat    73 GEAAAFDLRQESG------------NNEVIFMA----LDLASLTSVQAFATAFLSSEPRLDILIH 121

  Fly   151 NAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDF--- 212
            |||:.....   |.:.|....:||::.||||||||||.|:.....|::.||:.||:..::||   
  Rat   122 NAGISSCGR---TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPSRVVIVSSAAHRRGRLDFTRL 183

  Fly   213 DDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMS 277
            |.|: || |..:.   .|:|.|||..:|..|.:|.:|:||.||.....||.|......|:.|.. 
  Rat   184 DCPV-VG-WQQEL---RAYADSKLANVLFARELATQLEGTGVTCYAAHPGPVNSELFLRHLPGW- 242

  Fly   278 SLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
               ::.:..|..||.::....|||..:..|....::.::|.||.:|.:...|...:|.:.|.:|:
  Rat   243 ---LRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSAAARDDQAAHRLW 304

  Fly   343 MQTIKTLESVTKLTVDREEYGL----DLQLEMESELR-------LEEPAEAEPETETNQAADEKK 396
            ..|.|..             ||    |...:.|.|.|       |..|:   || :|..:...:.
  Rat   305 KVTKKLA-------------GLGPEDDPDTDDEQEPRDPRAPSSLSAPS---PE-KTTISGPSRS 352

  Fly   397 WQGN 400
            :||:
  Rat   353 YQGS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 94/273 (34%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 101/294 (34%)
Dhrs13XP_038943561.1 retinol-DH_like_SDR_c_like 36..304 CDD:212492 101/295 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.