DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Wwox

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_006255728.1 Gene:Wwox / 292041 RGDID:1309927 Length:414 Species:Rattus norvegicus


Alignment Length:322 Identity:106/322 - (32%)
Similarity:149/322 - (46%) Gaps:50/322 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPED 114
            ::|:|||.|||||||.|::.|..|..:||||||:.....|.:.|..|.                .
  Rat   125 KVVLVTGANSGIGFETAKSFALHGAHVILACRNMSRASEAVSRILEEW----------------H 173

  Fly   115 RYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPF 179
            :..|||..|||..||||.|||....|:...:.:||.||| .||.....|:||.|...|||:|..|
  Rat   174 KAKVEAMTLDLAVLRSVQHFAEAFKAKNVPLHILVCNAG-TFALPWSLTKDGLETTFQVNHLGHF 237

  Fly   180 LLTHLLLPHLQRSEQGRILFVSAHAHQGAKI-DFDDPLNVGTWSVK---FHAREAFAHSKLCVLL 240
            .|..||...|.||...|::.||:.:|:...| |....|::...|:.   :.|..|:..||||.:|
  Rat   238 YLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSSGKLDLSRLSLSSSDYWAMLAYNRSKLCNIL 302

  Fly   241 ATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWL--------FMKNAY 297
            .:..:.|.|....||.|...||.:..:...|||              |::.        |.|:..
  Rat   303 FSNELHRLLSPRGVTSNALHPGNMMFSAIHRNS--------------WVYKLLFTLARPFTKSMQ 353

  Fly   298 EGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLYMQTIKTLESVTKLTVDR 359
            :||...:..|..|:|:.:.|.|||:|.....|...|::|.|:.|:       |...:|..||
  Rat   354 QGAATTVYCAVAPELEGLGGMYFNNCCRCLPSEEAQNEETARALW-------ELSERLIQDR 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 92/279 (33%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 101/303 (33%)
WwoxXP_006255728.1 WW 18..47 CDD:395320
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 104/319 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.