DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and SPCC736.13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_587784.1 Gene:SPCC736.13 / 2539566 PomBaseID:SPCC736.13 Length:339 Species:Schizosaccharomyces pombe


Alignment Length:325 Identity:91/325 - (28%)
Similarity:153/325 - (47%) Gaps:51/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPED 114
            ::.:|||.:.|||:..|..||.:|.::.||.||.|..::....|.            ||..:.:.
pombe    43 KVALVTGSSGGIGYVTALELARKGAKVYLAGRNEEKYQKVMKQIH------------DEVRHSKI 95

  Fly   115 RYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPF 179
            |:.    .|||....||:..|...:|:.|::.:||||||::....:: |:||:|...|.|||:.:
pombe    96 RFL----RLDLLDFESVYQAAESFIAKEEKLHILVNNAGIMNPPFEL-TKDGYELQIQTNYLSHY 155

  Fly   180 LLTHLLLPHLQRSEQG------RILFVSAHAHQGAK---IDFDDPLN-----VGTWSVKFHAREA 230
            |.|.||||.|:|:.:.      ||:.|::.|:..|.   |.|.| ||     :||::       .
pombe   156 LFTELLLPTLRRTAEECRPGDVRIVHVASIAYLQAPYSGIYFPD-LNLPHVLLGTFA-------R 212

  Fly   231 FAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKN 295
            :..||...:|.:..:|:.|:...:......||::| |...|.||..:...::...:.::.|   :
pombe   213 YGQSKYAQILYSIALAKRLEKYGIYSVSLHPGVIR-TELTRYSPTFALKLLEKSVFQYLLL---D 273

  Fly   296 AYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTG-----QDKELAKKLYMQTIKTLESVTKL 355
            ...||..::..||.|   |::.|:.|.....|.:..|     .|....::||..|.|..|.:..|
pombe   274 PIRGAMTSLYAATSP---EISKEHLNGAYFTAIAQRGILHRAHDDAFVEELYRYTHKIFEDLKYL 335

  Fly   356  355
            pombe   336  335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 80/281 (28%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 85/310 (27%)
SPCC736.13NP_587784.1 retinol-DH_like_SDR_c_like 42..322 CDD:212492 85/310 (27%)
adh_short 43..252 CDD:278532 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.