DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and CG30495

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:327 Identity:117/327 - (35%)
Similarity:170/327 - (51%) Gaps:27/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VGIV-ITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRA 89
            |||: ..||..|.|.:.........::.:|||||:|:|.|....||.||..:.:||||.|..:||
  Fly    21 VGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARRGATVYMACRNKEKVERA 85

  Fly    90 AAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGV 154
            ...|.:|.|     ||           .|.:|..||.||.|:..||.....|...:.:|:|||| 
  Fly    86 RREIVKETG-----NS-----------NVFSRECDLSSLDSIRKFAENFKKEQRVLHILINNAG- 133

  Fly   155 VFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVG 219
            ||......|::|||.|..||::..||||:|||..|:||...|::.|::.||:..:|..|| :|..
  Fly   134 VFWEPHRLTKEGFEMHLGVNHIGHFLLTNLLLGVLERSAPSRVVVVASRAHERGQIKVDD-INSS 197

  Fly   220 TWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRN----SPLMSSLC 280
            .:   :....|:..|||..:|.||.:|:.|:||.||||...|| :..|...||    ....:...
  Fly   198 DF---YDEGVAYCQSKLANILFTRELAKRLEGTGVTVNALNPG-IADTEIARNMIFFQTKFAQYV 258

  Fly   281 VKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLYMQT 345
            |:.:..|.:|..||....|||..:..|.||.|:.|:|:||:||.:|..:....|.::|:.|:.|:
  Fly   259 VETILRPLLWAVMKTPKNGAQTTLYAALDPDLERVSGQYFSDCALAPVAPAALDDQMAQWLWAQS 323

  Fly   346 IK 347
            .|
  Fly   324 EK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 99/274 (36%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 107/295 (36%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 99/273 (36%)
NADB_Rossmann 45..323 CDD:304358 108/299 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448983
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
98.900

Return to query results.
Submit another query.