DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and DC2.5

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_503155.4 Gene:DC2.5 / 183970 WormBaseID:WBGene00017082 Length:337 Species:Caenorhabditis elegans


Alignment Length:302 Identity:86/302 - (28%)
Similarity:138/302 - (45%) Gaps:41/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFV 118
            :||..||:|.|.|:|...:|..|::..||..|.:    .:|:.|.|.||...:|         .|
 Worm    50 ITGTTSGVGTETARAFILKGAHIVMINRNYAASE----TLKQSLLCETPDARID---------IV 101

  Fly   119 EARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTH 183
            :.   ||.||.||...|.:.:.:...:..|:.||||: ...:..|.|.||.|..:|:||.|||..
 Worm   102 QC---DLSSLASVKKTAEEYLTKKWPLHGLILNAGVL-GRKEKTTADRFEAHFGINHLAHFLLIK 162

  Fly   184 LLLPHLQRSEQGRILFVSAHAHQGAKIDFDD----------PLNVGTWSVKFHAREAFAHSKLCV 238
            .|||.|:.|...||:.:|:...:...|:.|.          |.|...|..:.:|:     ||:|.
 Worm   163 ELLPVLRSSAPSRIVILSSTLSKFTSINPDSKIEEKLGTLCPKNATEWYYRLYAK-----SKMCN 222

  Fly   239 LLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCA 303
            :|....:.|:.....::|....||....|...|:.|..|.....::.      |.|||.:||..:
 Worm   223 MLIAFKLHRDEFENGISVYSVHPGSAVRTNLHRDVPFWSIFNFLSIP------FTKNASQGAATS 281

  Fly   304 IRLATDPQLKEVTGEYFNDC---EIAASSVTGQDKELAKKLY 342
            :..|..|:::|::|.|:..|   |:.......:|:||.:.|:
 Worm   282 LYCAVHPEVQELSGRYWESCWDDELNLDEKVARDEELQEALW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 78/273 (29%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 85/300 (28%)
DC2.5NP_503155.4 PRK06196 28..331 CDD:235736 86/302 (28%)
retinol-DH_like_SDR_c_like 45..323 CDD:212492 85/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.