DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and dhs-7

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_495500.1 Gene:dhs-7 / 174183 WormBaseID:WBGene00000971 Length:329 Species:Caenorhabditis elegans


Alignment Length:324 Identity:86/324 - (26%)
Similarity:152/324 - (46%) Gaps:47/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYF 117
            ||||..||||.|.|::|:..|..:::..||||..::    :|:::        ::|.::.|    
 Worm    32 VVTGTTSGIGIETARSLSLNGAHVVMLNRNLEESEK----LKKKI--------VEEMNDAE---- 80

  Fly   118 VEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLT 182
            ::....||.||.||...|...:::...|..|:.||| ||......|.||.|.|..:|:|:.|||.
 Worm    81 IDIIECDLNSLHSVKKAAEVYISKKWSIHCLILNAG-VFGTASKTTVDGLESHFAINHLSHFLLI 144

  Fly   183 HLLLPHLQRSEQGRILFVSAHAHQ----GAKIDFDDPLNV--------GTWSVKFHAREAFAHSK 235
            ..|||.:::|...||:.||:..|.    ..::..::.|.:        .:|.      ..::.||
 Worm   145 QELLPIVRQSIPSRIVLVSSSVHATCGVSPEMSIEEKLKILCPESSSDASWF------RLYSRSK 203

  Fly   236 LCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGA 300
            :|.:|....:.|:.....::.....||....|..||:|.|:|...:.:..      |.||..:||
 Worm   204 MCNMLVAFKLHRDEYHNGISTYSVHPGNGVRTSIFRDSWLVSIASILSTP------FTKNISQGA 262

  Fly   301 QCAIRLATDPQLKEVTGEYFN---DCEIAASSVTGQDKELAKKLYMQTIKTLESVTKLTVDREE 361
            ...:..|..|::..|:|:|::   |.|........:|::|...|:..:.|.|:::..   ||::
 Worm   263 STTVYCAGHPEVANVSGKYWDSNWDDEKGLYEEVARDEQLQDALWKHSDKILDNMLN---DRKK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 75/276 (27%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 81/303 (27%)
dhs-7NP_495500.1 PRK06197 28..313 CDD:235737 82/309 (27%)
retinol-DH_like_SDR_c_like 28..307 CDD:212492 81/303 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.