DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Rdh11

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_067532.2 Gene:Rdh11 / 17252 MGIID:102581 Length:316 Species:Mus musculus


Alignment Length:318 Identity:113/318 - (35%)
Similarity:174/318 - (54%) Gaps:42/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRE 96
            :|.::|...|.::.|:..::.:|||.|:|||.|.|:.||.||.|:.||||:::.|:.||..|:..
Mouse    21 IRKMLSSGVCTSNVQLPGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAREIQAV 85

  Fly    97 LGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQM 161
            .|     ||         :.||  |.|||...:|:..||...:||.:.:.:|:|||||:.. ...
Mouse    86 TG-----NS---------QVFV--RKLDLADTKSIRAFAKDFLAEEKHLHLLINNAGVMMC-PYS 133

  Fly   162 PTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFH 226
            .|.||||.|..||:|..||||||||..|:.|...||:.:|:..|...:|.|.:     ....||:
Mouse   134 KTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNLSSLGHHLGRIHFHN-----LQGEKFY 193

  Fly   227 -AREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRG--TRHFRNSPLMSSLCVKAVTYPW 288
             |..|:.||||..:|.|:.:|:.|||:.||.....||.|..  ||:   |.:|.          |
Mouse   194 SAGLAYCHSKLANILFTKELAKRLKGSGVTTYSVHPGTVHSELTRY---SSIMR----------W 245

  Fly   289 MW----LFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
            :|    :|:|...||||.::..|....|:.::|.:|:||::|..|..|:::.:|::|:
Mouse   246 LWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSHFSDCQLAWVSYQGRNEIIARRLW 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 100/277 (36%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 108/298 (36%)
Rdh11NP_067532.2 PRK06197 38..311 CDD:235737 109/301 (36%)
NADB_Rossmann 38..306 CDD:304358 109/301 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.