DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and DHRS13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_653284.2 Gene:DHRS13 / 147015 HGNCID:28326 Length:377 Species:Homo sapiens


Alignment Length:389 Identity:116/389 - (29%)
Similarity:179/389 - (46%) Gaps:49/389 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AALTVG-IVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRNLEA 85
            |.|.:| .|:....|:....|.....::.:..||||.|||||...|..||.||.|::||||:.|.
Human     8 AGLLLGAYVLVYYNLVKAPPCGGMGNLRGRTAVVTGANSGIGKMTALELARRGARVVLACRSQER 72

  Fly    86 GKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVN 150
            |:.||..:::|.|            |.|..:..    |||.||.||..||...::...|:|:|::
Human    73 GEAAAFDLRQESG------------NNEVIFMA----LDLASLASVRAFATAFLSSEPRLDILIH 121

  Fly   151 NAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKIDF--- 212
            |||:.....   |.:.|....:||::.||||||||||.|:.....|::.|::.||...::||   
Human   122 NAGISSCGR---TREAFNLLLRVNHIGPFLLTHLLLPCLKACAPSRVVVVASAAHCRGRLDFKRL 183

  Fly   213 DDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPLMS 277
            |.|: || |..:.   .|:|.:||..:|..|.:|.:|:.|.||.....||.|......|:.|.. 
Human   184 DRPV-VG-WRQEL---RAYADTKLANVLFARELANQLEATGVTCYAAHPGPVNSELFLRHVPGW- 242

  Fly   278 SLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKKLY 342
               ::.:..|..||.::....|||..:..|....::.::|.||.:|.:.......:|...|.:|:
Human   243 ---LRPLLRPLAWLVLRAPRGGAQTPLYCALQEGIEPLSGRYFANCHVEEVPPAARDDRAAHRLW 304

  Fly   343 MQTIKTLESVTKLT-------VDREEYGLDLQLEMESELRL---EEPAEAEPETETNQAADEKK 396
                   |:..:|.       .:.:|.......|..|.|..   |||..::|......:.|..|
Human   305 -------EASKRLAGLGPGEDAEPDEDPQSEDSEAPSSLSTPHPEEPTVSQPYPSPQSSPDLSK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 91/273 (33%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 97/294 (33%)
DHRS13NP_653284.2 retinol-DH_like_SDR_c_like 36..304 CDD:212492 97/295 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..377 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.790

Return to query results.
Submit another query.