DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and RDH13

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:334 Identity:127/334 - (38%)
Similarity:193/334 - (57%) Gaps:30/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PTIAALTV-GIVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRN 82
            |..|..|| |..:.::..::|..||:...|..:.|:|||.|:|||.:.|..||.|||.||||||:
Human     7 PLSALGTVAGAAVLLKDYVTGGACPSKATIPGKTVIVTGANTGIGKQTALELARRGGNIILACRD 71

  Fly    83 LEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDV 147
            :|..:.||..|:.|     .||           :.|.||:|||.||:|:..||.:::.|.||:|:
Human    72 MEKCEAAAKDIRGE-----TLN-----------HHVNARHLDLASLKSIREFAAKIIEEEERVDI 120

  Fly   148 LVNNAGVVFANTQMP---TEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAK 209
            |:|||||:    :.|   ||||||....||:|..||||:|||..|:.|...||:.:|:.||....
Human   121 LINNAGVM----RCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDKLKASAPSRIINLSSLAHVAGH 181

  Fly   210 IDFDDPLNVGTWSV-KFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNS 273
            ||||| ||   |.. |::.:.|:..|||.::|.|:.::|.|:|:.||||...||:.| |...|::
Human   182 IDFDD-LN---WQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNALHPGVAR-TELGRHT 241

  Fly   274 PLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELA 338
            .:..|........|..||.:|:....||.:..||...:|.:|:|:||:..:..|.:...:|:|:|
Human   242 GIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDEEVA 306

  Fly   339 KKLYMQTIK 347
            ::|:.::.:
Human   307 RRLWAESAR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 111/274 (41%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 117/295 (40%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 118/299 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.