DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Cbr3

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:319 Identity:80/319 - (25%)
Similarity:125/319 - (39%) Gaps:99/319 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QIVVVTGGNSGIGFEIAQALAGR-GGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPE 113
            ::.:|||.|.||||.|.:.|..: .|.::|..|:...|:.|...::.| |.....:.||.|| |:
Mouse     6 RVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVQQLQAE-GLSPRFHQLDIDD-PQ 68

  Fly   114 DRYFVEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAP 178
                         |:|::..|   |..|:..::|||||||:.|   :|.....|:..::|.....
Mouse    69 -------------SIRALRDF---LRKEYGGLNVLVNNAGIAF---RMDDPTPFDIQAEVTLKTN 114

  Fly   179 FLLTH--------LLLPHLQRSEQGRILFVSA----HAHQGAKIDFDDPLNVGTWS--------V 223
            |..|.        ::.||      ||::.:|:    .|.:..:.|..:.....|.:        .
Mouse   115 FFATRNVCTELLPIMKPH------GRVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMK 173

  Fly   224 KF--------HARE-----AFAHSKLCVLLATRWMAREL----KGTSVTVNCCTPGLVR------ 265
            ||        |.||     |:..|||.|.:.||.:||:|    |...:.:|.|.||.|:      
Mouse   174 KFVEDTKNEVHEREGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARD 238

  Fly   266 -GTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLA-TDPQLKEVTGEYFND 322
             |:|                          ...|||:..:.|| ..|...|..|:...|
Mouse   239 QGSR--------------------------TVEEGAETPVYLALLPPDATEPHGQLVRD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 78/313 (25%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 80/319 (25%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 80/319 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.