DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and Rdh14

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_076186.1 Gene:Rdh14 / 105014 MGIID:1920402 Length:334 Species:Mus musculus


Alignment Length:332 Identity:122/332 - (36%)
Similarity:178/332 - (53%) Gaps:29/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAALTVGIVITVRTLMSGQRCPNDNQ--------IKEQIVVVTGGNSGIGFEIAQALAGRGGRII 77
            :|||...:.:..|. .||.|  |..|        :..:.|::||.|||:|...|..|...|.|:|
Mouse    11 LAALGGALWLAARR-FSGPR--NQRQQGGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVI 72

  Fly    78 LACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEF 142
            :.||:....:.||..:::|| |:......|..|..     :..:.|||.|||||..|..:|:.|.
Mouse    73 MGCRDRARAEEAAGQLRQEL-CQAGGAGPDGTDGQ-----LVVKELDLASLRSVRAFCQELLQEE 131

  Fly   143 ERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQG 207
            .|:|||:|||| ||......||||||....||:|..||||:|||..|:.|...||:.||:..::.
Mouse   132 PRLDVLINNAG-VFHCPYTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKY 195

  Fly   208 AKIDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGT--RHF 270
            .:|:|:|..:..:::..|    .::.|||..:|.||.:||.|:||:||||...||:||..  ||.
Mouse   196 GEINFEDLNSEQSYNKSF----CYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHI 256

  Fly   271 RNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDK 335
             :.||::......|:    |.|.|...||||.:|.||..|.::.|:|.||.||:.........|:
Mouse   257 -HIPLLARPLFNLVS----WAFFKTPLEGAQTSIYLACSPDVEGVSGRYFGDCKEEELLPKAMDE 316

  Fly   336 ELAKKLY 342
            .:|:||:
Mouse   317 SVARKLW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 104/272 (38%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 112/293 (38%)
Rdh14NP_076186.1 PRK06197 43..332 CDD:235737 113/297 (38%)
NADB_Rossmann 44..326 CDD:304358 113/296 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.