DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and dhrsx

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:343 Identity:105/343 - (30%)
Similarity:167/343 - (48%) Gaps:46/343 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PTIAALTVGIVITVRTLMSGQRC------PNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRII 77
            |.:.....|:.:.::.:. |:|.      |:.|   .::.:||||..|||:..|:.|:..|..:|
 Frog     9 PILRVYYTGLRVILQQVY-GRRAFSLPVIPSQN---GKVAIVTGGAKGIGYSTAKHLSSLGMHVI 69

  Fly    78 LACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEF 142
            :|..|...|..|             :..:.:|.:.|.   ||..|.||.|::|:..|.....|:.
 Frog    70 IAGNNEAEGSEA-------------VTRIQQDTHNEK---VEFLYCDLASMKSIRQFVQIFKAKN 118

  Fly   143 ERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSE----QGRILFVSAH 203
            ..:.||||||||:.. .:..|.||||.|..:|||..||||:|||...:.|.    ..||:.||:.
 Frog   119 LCLHVLVNNAGVMLV-PERKTADGFEEHFGLNYLGHFLLTNLLLKTTKESGTENLNARIITVSSA 182

  Fly   204 AHQGAKIDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMARELK--GTSVTVNCCTPGLVRG 266
            .|...:::||| ||.   |..:....|:|.|||.:::.|.::.|:|.  |..||.|...||:|  
 Frog   183 THYVGELNFDD-LNS---SCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCYVTANVVDPGVV-- 241

  Fly   267 TRHFRNSPLMSSLCVKAVTYPWM--WLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASS 329
                 |:.|..::|.......||  .||.|.|.|||..:|..:..|:|:.:.|.|..:.:...|:
 Frog   242 -----NTDLYRNVCWPGRLVKWMAARLFFKTAEEGAATSIYASVAPELEGIGGCYLYNGQKTKSA 301

  Fly   330 VTGQDKELAKKLYMQTIK 347
            ....:::|.:||:.::.|
 Frog   302 DISYNEDLQRKLWNESCK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 92/278 (33%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 97/299 (32%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 97/300 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.