DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment naz and dhrs12lb

DIOPT Version :9

Sequence 1:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_002660947.2 Gene:dhrs12lb / 100334077 ZFINID:ZDB-GENE-131121-6 Length:345 Species:Danio rerio


Alignment Length:307 Identity:83/307 - (27%)
Similarity:138/307 - (44%) Gaps:47/307 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VVTGGNSGIGFEIAQALAGRGGRIILACRNLEAGKRAAAIIKRELGCRTPLNSLDEDDNPEDRYF 117
            ::||.|||||...|.|:|.:||.:.:.|||.|..:||...|....|     |::           
Zfish    64 MITGANSGIGKATAMAIAKKGGTVHIVCRNKEKAERAREEIVSASG-----NTM----------- 112

  Fly   118 VEARYLDLCSLRSVHHFAGQLMAEFERIDVLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLT 182
            |....|||...|.|..||.....|...::||:||||.: .|.:....||.|::...|.|..::||
Zfish   113 VFVHVLDLSESRKVWEFAEAFKKEHTSLNVLINNAGCM-VNQREINSDGLEKNFATNTLGVYILT 176

  Fly   183 HLLLPHLQRSEQGRILFVSAHAHQGAKIDFDDPLNVGTWSVKFHAREAFAHSKLCVLLATRWMAR 247
            ..|:|.|::|...|::.||:......|::.||   :.|...:|.|...:|.:|...::.|.:.|:
Zfish   177 KCLIPLLEKSRDPRVITVSSGGMLVQKLNPDD---LQTERAQFDATMVYAQNKRQQVVMTEFWAK 238

  Fly   248 ELKGTSVTVNCCTPGLVRGTRHFRNSPLMSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQL 312
            ..  ..:..:...||       :.::|.::|...:  .|..|...:::|.:|:...|.||    :
Zfish   239 AY--PKIHFSVMHPG-------WADTPAVASAMPQ--FYQLMRDRLRSAEQGSDTLIWLA----M 288

  Fly   313 KEVT-----GEYFND-----CEIAASSVTGQDKELAKKLYMQTIKTL 349
            ..||     |.:|.|     ..:..:......||  .|.:|:.::||
Zfish   289 SRVTITFPSGLFFQDRQPVSVHLPLAWTHSPRKE--GKAFMRRLETL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nazNP_001287387.1 FabG 47..318 CDD:223959 74/269 (28%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 80/298 (27%)
dhrs12lbXP_002660947.2 SDR 60..314 CDD:330230 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.