DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKD and CPK17

DIOPT Version :9

Sequence 1:NP_001262705.1 Gene:PKD / 42203 FlyBaseID:FBgn0038603 Length:906 Species:Drosophila melanogaster
Sequence 2:NP_196779.1 Gene:CPK17 / 831091 AraportID:AT5G12180 Length:528 Species:Arabidopsis thaliana


Alignment Length:273 Identity:86/273 - (31%)
Similarity:142/273 - (52%) Gaps:10/273 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 VQDMGQLYQIFPDEVLGSGQFGVVYGGVHKKTQREVAIKVIDKLRFPTKQEAQ-LKNEVAILQNI 597
            ::|:...|.:  .:.||.|||||.:....|.|..:.|.|.|.|.:...|::.: ::.||.|:.::
plant    66 MEDVKASYSL--GKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMHHL 128

  Fly   598 S-HCGVVNLERMFETPERIFVVMEKLK-GDMLEMILSHARGRLSERVTKFLITQILIALKYLHSQ 660
            : ...:|.|:..:|....:.:|||... |::.:.|:  |:|..|||....|:..|:..:...||.
plant   129 TGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRII--AKGHYSERAAASLLRTIVQIVHTCHSM 191

  Fly   661 NIVHCDLKPENVLLSSDAEFPQVKLCDFGYARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLD 725
            .::|.||||||.||.:..|...:|..|||.:.........:.:||:..|:|||||:.| |....|
plant   192 GVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKPGEVFKDIVGSAYYIAPEVLKRK-YGPEAD 255

  Fly   726 MWSVGVIIYVSLSGTFPF--NEEEDINDQIQNAAFMYPPNPWKEISSNAIDLINNLLQVKQRKRY 788
            :||:||::|:.|.|..||  ..|..|.:.|......:..:||..||..|.||:..:|....::|.
plant   256 IWSIGVMLYILLCGVPPFWAESENGIFNAILRGHVDFSSDPWPSISPQAKDLVKKMLNSDPKQRL 320

  Fly   789 TVDKSLLHYWLQD 801
            |..:.|.|.|:::
plant   321 TAAQVLNHPWIKE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKDNP_001262705.1 C1_1 109..154 CDD:278556
C1 223..272 CDD:197519
PH_PKD 396..522 CDD:269945
STKc_PKD 539..798 CDD:270984 84/263 (32%)
S_TKc 547..799 CDD:214567 83/256 (32%)
CPK17NP_196779.1 STKc_CAMK 73..330 CDD:270687 84/261 (32%)
PTZ00184 371..510 CDD:185504
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.