DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKD and CPK27

DIOPT Version :9

Sequence 1:NP_001262705.1 Gene:PKD / 42203 FlyBaseID:FBgn0038603 Length:906 Species:Drosophila melanogaster
Sequence 2:NP_192379.2 Gene:CPK27 / 825805 AraportID:AT4G04700 Length:485 Species:Arabidopsis thaliana


Alignment Length:278 Identity:85/278 - (30%)
Similarity:150/278 - (53%) Gaps:10/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 EEQVQDMGQLYQIFPDEVLGSGQFGVVYGGVHKKTQREVAIKVIDKLRFPTKQ-EAQLKNEVAIL 594
            |:.:.|:.::|.:  .|.||.|.||:....|.|.|.:..|.|.|.|.:...:: |..:|.|:.|:
plant    18 EKPLVDITKIYIL--GEELGRGNFGLTRKCVEKSTGKTFACKTILKTKLKDEECEEDVKREIRIM 80

  Fly   595 QNIS-HCGVVNLERMFETPERIFVVMEKL-KGDMLEMILS-HARGR-LSERVTKFLITQILIALK 655
            :.:| ...:|..:..:|..:.:.:|||.. .|::.:.||: :..|: .||:....:|..|:..:|
plant    81 KQLSGEPNIVEFKNAYEDKDSVHIVMEYCGGGELYDKILALYDVGKSYSEKEAAGIIRSIVNVVK 145

  Fly   656 YLHSQNIVHCDLKPENVLLSSDAEFPQVKLCDFGYARIIGEKSFRRSVVGTPAYLAPEVLRNKGY 720
            ..|...::|.||||||.||:|:.:...||:.|||.:..|.|....:.:.|:..|:|||||:. .|
plant   146 NCHYMGVMHRDLKPENFLLTSNDDNATVKVIDFGCSVFIEEGKVYQDLAGSDYYIAPEVLQG-NY 209

  Fly   721 NRSLDMWSVGVIIYVSLSGTFPFNEEED--INDQIQNAAFMYPPNPWKEISSNAIDLINNLLQVK 783
            .:..|:||.|:|:|:.|.|..||.:|.:  :.::|::....|...||....|.||.|:..:|...
plant   210 GKEADIWSAGIILYILLCGKSPFVKEPEGQMFNEIKSLEIDYSEEPWPLRDSRAIHLVKRMLDRN 274

  Fly   784 QRKRYTVDKSLLHYWLQD 801
            .::|.:..:.|.|.|:::
plant   275 PKERISAAEVLGHPWMKE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKDNP_001262705.1 C1_1 109..154 CDD:278556
C1 223..272 CDD:197519
PH_PKD 396..522 CDD:269945
STKc_PKD 539..798 CDD:270984 82/265 (31%)
S_TKc 547..799 CDD:214567 81/258 (31%)
CPK27NP_192379.2 S_TKc 28..290 CDD:214567 82/264 (31%)
STKc_CAMK 28..289 CDD:270687 82/263 (31%)
PTZ00184 325..468 CDD:185504
EFh 337..396 CDD:238008
EFh 411..469 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.