DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18600 and AT3G13940

DIOPT Version :9

Sequence 1:NP_650708.1 Gene:CG18600 / 42201 FlyBaseID:FBgn0038601 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_188010.1 Gene:AT3G13940 / 820607 AraportID:AT3G13940 Length:442 Species:Arabidopsis thaliana


Alignment Length:371 Identity:70/371 - (18%)
Similarity:147/371 - (39%) Gaps:58/371 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DGKKHALVYA---GDQV------YTGEVKDSEEVDTY-IFIRNKLTNKVKVVPVQEALMYNHVYK 98
            |.||...|..   |.:|      |||| :.:.:.:|| :.:.|:....::::||    .:|.:. 
plant    98 DSKKRIQVVVSPPGARVEFVGTNYTGE-QAAMQTNTYRVGVFNREAKTLRILPV----AHNKII- 156

  Fly    99 KLERQKRTGPTMSREHANKKLLKEFGGRKASRFVDNREQMMVNVEVMRQDLDETVNSSMLNEDEE 163
            :||.:.:...|...|.:...::||....|..    .|::......|.|   |:...:..:.:|..
plant   157 RLEPRVKAQETNEEEASGSAVVKELEELKTG----ERDRYNTKKAVTR---DKKKRALYMGDDAA 214

  Fly   164 -----DGTLGDVSIN------NEEYLASIVPEFNKEATKVDEVYAVESLIPS---SLLE----RL 210
                 ||.|.::.:|      ....:|..:|.:|..||..:|.|.:|.:|..   |.||    .|
plant   215 TQKVLDGKLSELGVNTAALEGTSSTVARNIPPYNTAATTANEAYPLEKIIEKGDWSFLEDIYWLL 279

  Fly   211 EEEAKVVFSTPVQTLPIKSEYLKSCLAKIQENPVSSKRDFLHIKLIIYMDALQSLISLRSRQMQK 275
            ::|.:..    .:..|:   ::::.|.::::    .|.|.....:......|..|:..:.|....
plant   280 QQETEAA----TEAYPV---FVRNRLYRLRD----IKDDMKKQTVCGAATLLTHLVKFKDRNSMN 333

  Fly   276 AELSGITEKIENDIRHRFADPNVAKKGTRTNFSSEKALTHFIVMALLLSEKFEVDINVLSRALAT 340
            ...|....|:.:..|.:|.......:..|........|..::::..|..:.|..|...:::.|..
plant   334 GYDSAKDHKMPDIFRQKFNSMFKDSESDRIPVDKINLLISYVLVLSLHVDNFMTDPEDIAKDLRI 398

  Fly   341 TKARIKQYAHIVNA----LPKSNSDILSLRLPSKVPALKSGRRFQR 382
            :...:::  |.:..    |.::::.:.:|..|...|.:...||.::
plant   399 STVELRK--HFLQLGCKFLKQNSTTVATLPTPLNFPEVNRRRRARK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18600NP_650708.1 RNA_pol_I_A49 33..379 CDD:284324 68/366 (19%)
AT3G13940NP_188010.1 RNA_pol_I_A49 89..439 CDD:399688 68/366 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D800331at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14440
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.