DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1E and Polr1e

DIOPT Version :10

Sequence 1:NP_650708.1 Gene:Polr1E / 42201 FlyBaseID:FBgn0038601 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001272729.1 Gene:Polr1e / 64424 MGIID:1929022 Length:482 Species:Mus musculus


Alignment Length:33 Identity:8/33 - (24%)
Similarity:16/33 - (48%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SSVGYNTDLQSTGHEFKSGLVPSGLLSLEIDEY 40
            :|..|:.:..||.....:.::|:.|:.|....|
Mouse    77 NSSRYDCNPVSTAAVLLADILPTLLIKLTAPFY 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1ENP_650708.1 RNA_pol_I_A49 33..372 CDD:462024 2/8 (25%)
Polr1eNP_001272729.1 RNA_pol_I_A49 51..467 CDD:462024 8/33 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 460..482
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.