| Sequence 1: | NP_650708.1 | Gene: | Polr1E / 42201 | FlyBaseID: | FBgn0038601 | Length: | 384 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001272729.1 | Gene: | Polr1e / 64424 | MGIID: | 1929022 | Length: | 482 | Species: | Mus musculus |
| Alignment Length: | 33 | Identity: | 8/33 - (24%) |
|---|---|---|---|
| Similarity: | 16/33 - (48%) | Gaps: | 0/33 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 SSVGYNTDLQSTGHEFKSGLVPSGLLSLEIDEY 40 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Polr1E | NP_650708.1 | RNA_pol_I_A49 | 33..372 | CDD:462024 | 2/8 (25%) |
| Polr1e | NP_001272729.1 | RNA_pol_I_A49 | 51..467 | CDD:462024 | 8/33 (24%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 460..482 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||