DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18600 and polr1e

DIOPT Version :9

Sequence 1:NP_650708.1 Gene:CG18600 / 42201 FlyBaseID:FBgn0038601 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001018540.1 Gene:polr1e / 553733 ZFINID:ZDB-GENE-050522-251 Length:413 Species:Danio rerio


Alignment Length:425 Identity:88/425 - (20%)
Similarity:170/425 - (40%) Gaps:97/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILKFQNGSLLG--DADFSMVEST------------VDGKKHALVYAGDQVYTGEVKDSEEVDTYI 72
            |:||.||::..  :.||::.:.:            |......|.|.|....:|.::.:.....::
Zfish    19 IVKFSNGNVKNAEELDFTVFKHSNASNPRKKNRRIVVADSDRLPYVGSNFGSGSLQSNNMCKYFV 83

  Fly    73 FIRNKLTNKVKVVPVQEALMYNHV----YKKLERQKRTGPTMSREHANKKLLKEFGGRKASRFVD 133
            .:.:|.|.::|   |..|.::|.:    .:..|.:....|:..|:..: .|::.||..|..|.:.
Zfish    84 GVLDKQTMQMK---VHSAQLFNMLPVIPGEATEAESENQPSTFRDKVD-ALIEAFGTNKQKRALS 144

  Fly   134 NREQMMVNVEVMRQD--------LDETVNSSMLNEDEEDGTLGDVSINNEEYLASIVPEFNKEAT 190
            :|....|..|.:.|.        :|:....::.||..|.....|.::        .:|..|..|.
Zfish   145 SRRLNAVGNETLHQAVAQAASNIIDQKGVEALRNEVIETEAQSDAAL--------FLPPCNANAD 201

  Fly   191 KVDEVYAVESLIPSSLLERLEE-EAKVVFSTPVQTLPIKSEYLKSCLAKIQENPVSSKRDFLHIK 254
            |:::||..:.|:..:..|.|:| .||  ::|      :.||.|:    |:::|....       .
Zfish   202 KLEDVYPFDQLLTPNEFESLKEVGAK--YAT------LSSEDLQ----KMRDNHCPQ-------T 247

  Fly   255 LIIYMDALQSLISLRSRQMQKAELSG--ITEKIENDIRHRFAD----PNVAKKGTRTNFSSEK-- 311
            ::.:::.|....:.|.||.:.|....  |...::..|..:|..    |.:.......||:.|.  
Zfish   248 VLKHLETLSKDEADRDRQCRCAWYLSFVIRASLQKRISFKFGSDDGCPRIIINKVLKNFTVESFH 312

  Fly   312 --ALTHFIVM-----------ALLLSEKFE-VDINVLSRALATTKARIKQYAHIV-------NAL 355
              :|.:.:.|           ||||....: .::.:|.|.::.::.::.:.|..:       |||
Zfish   313 NGSLRNTVSMSMRMKMASYCLALLLHMGGQTANLTLLHRDMSISENKMLEVAKAMGLTLSRQNAL 377

  Fly   356 PKSNSDI------LSLRLPSKVPALKSGRRFQRKK 384
            .|....|      :||.|    |.:...||.:|||
Zfish   378 GKEGGLIEDEHRMVSLVL----PLVHYDRRTERKK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18600NP_650708.1 RNA_pol_I_A49 33..379 CDD:284324 78/405 (19%)
polr1eNP_001018540.1 RNA_pol_I_A49 30..398 CDD:284324 78/402 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346946at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14440
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.