DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18600 and Polr1e

DIOPT Version :9

Sequence 1:NP_650708.1 Gene:CG18600 / 42201 FlyBaseID:FBgn0038601 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001101408.1 Gene:Polr1e / 313245 RGDID:1565773 Length:434 Species:Rattus norvegicus


Alignment Length:424 Identity:95/424 - (22%)
Similarity:176/424 - (41%) Gaps:70/424 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CDHKRDENIPTILKFQNGSLL--GDADFSMVEST------------VDGKKHALVYAGDQVYTGE 61
            |....|.....:::|.||.|.  |:..|::..||            :..:...|.|.|:...||.
  Rat    29 CGEPDDRQKAVLVQFSNGKLQNPGNMRFTLYNSTDLVNPRQKCHRILAAETDRLSYVGNNFGTGA 93

  Fly    62 VKDSEEVDTYIFIRNKLTNKVKVVPVQEALMYNHVYKKLERQKRTGPTMSREHANK----KL--- 119
            :|.:.....::.|.||.:.:::   |.:|.::|......|.....||.:  |:.||    ||   
  Rat    94 LKCNTLCRHFVGILNKTSGQME---VYDAEVFNMQPLFAEDSIEHGPPL--ENQNKTFRDKLDSC 153

  Fly   120 LKEFGGRKASRFVDNREQMMVNVEVMR-------QDLDETVNSSMLNEDEEDGTLGDVSINNEEY 177
            ::.||..|..|.:::|....|..|.:.       :.:.:|...|.|..|    .:.|...|:..|
  Rat   154 IEAFGSTKQKRSLNSRRMNKVGSESLNFTVAKAAESIIDTKGVSALVSD----AMQDDLQNDSLY 214

  Fly   178 LASIVPEFNKEATKVDEVYAVESLIPSSLLERLE---EEAKVVFSTPVQTLPIKSEYLKSCLAKI 239
            |    |..:.:|||.::||..|.::..:..:.||   |..:.|.|..:..:..::.:....:..:
  Rat   215 L----PPCHADATKPEDVYRFEDILSPAEYDALESPSEAFRKVMSEDILKMVEENSHCSFIIEML 275

  Fly   240 QENPVSSKRDFLHIKLIIYMDALQSLISLRSRQMQKAELS---GITEKIENDIRHRFADPNVAKK 301
            :..|....:.....:.|.::||   |:..|::::.|.:.:   ||...|...:..:|........
  Rat   276 KSLPADEVQRNRQARSIWFLDA---LLRFRAQKVIKGKSALGPGIPHIINTKLLKQFTCLTYNNG 337

  Fly   302 GTRTNFSSE---KALTHFIVMALLLSEKFEVDINVLSRALATTKARIKQYAHIVN--------AL 355
            ..|...||.   |...:.|::||.:: .|::|:.||.|.|..::.|:.:.|..:.        :|
  Rat   338 SLRNLISSSMKAKITAYAIILALHIN-NFQIDLTVLQRDLKLSEKRMIEIARAMRLKISKRKVSL 401

  Fly   356 PKSNSD-----ILSLRLPSKVPALKSGRRFQRKK 384
            .....:     .||:.||   ||..|.|:.:|||
  Rat   402 ADGREEDHRLGTLSVPLP---PAQTSDRQSKRKK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18600NP_650708.1 RNA_pol_I_A49 33..379 CDD:284324 84/393 (21%)
Polr1eNP_001101408.1 RNA_pol_I_A49 51..427 CDD:284324 85/395 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340675
Domainoid 1 1.000 52 1.000 Domainoid score I11226
eggNOG 1 0.900 - - E1_KOG4183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5322
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346946at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14440
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.