DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18600 and polr1e

DIOPT Version :9

Sequence 1:NP_650708.1 Gene:CG18600 / 42201 FlyBaseID:FBgn0038601 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001120306.1 Gene:polr1e / 100145368 XenbaseID:XB-GENE-1003651 Length:419 Species:Xenopus tropicalis


Alignment Length:425 Identity:90/425 - (21%)
Similarity:163/425 - (38%) Gaps:89/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILKFQNGSLLG--DADFSMVESTVDGKKHA------------LVYAGDQVYTGEVKDSEEVDTYI 72
            :::|.||::..  ..:|::..:..|....|            |.|..:...:..||.:.....::
 Frog    21 VVQFSNGTIQSPESVNFTLYSNKDDNNPKAKRQRILAAETDRLSYVANNFTSDAVKSNSLCRYFV 85

  Fly    73 FIRNKLTNKVKVVPVQEALMYNHVYKKLERQKRTGPTM---SREHANK--KLLKEFGGRKASRFV 132
            .:.||.|.|::|...::..|...:....|::..|...|   |:.:..|  .|::.||..|..|.:
 Frog    86 GVLNKETGKMEVYDSEQYRMQPILESNKEKELHTEDVMDQPSKSYREKVDALIESFGTNKQKRAL 150

  Fly   133 DNREQMMVNVEVMRQDLDETVNSSMLNEDEE----DGT---LGDVSINNEEYLASIVPEFNKEAT 190
            .:|:...|..|::        |.:|....||    .||   :.|.....::..:..:|..:..|.
 Frog   151 SSRKLNQVGSEIL--------NKAMAKAAEEIIESRGTKELVKDAVDKKQQETSLFLPPCDYNAN 207

  Fly   191 KVDEVYAVESLIPSSLLERLEEEAKVVFSTPVQTLPIKSEYLKSCLAKIQE----NPVSSKRDFL 251
            |.:..|..:.||.......||..:....:...:.|....|..||.|..:||    ..:..::...
 Frog   208 KPENAYKFDDLISPVEYAALETASAAFRNMTSEDLLQMVENKKSGLFVLQELQGLREIKDEKALD 272

  Fly   252 H-IKLIIYMDALQSLISLRS---RQMQKAELSGI---------------TEKIENDIRHRFADPN 297
            | .:.:.|:|||..|..||:   :.:...|..||               ..:|:|.|        
 Frog   273 HQARCLWYLDALIKLSQLRTVKRKDIMTPECPGIICGKLMKNFTVEVFKNGRIQNSI-------- 329

  Fly   298 VAKKGTRTNFSSEKALTHFIVMALLLSEKFEVDINVLSRALATTKARIKQYAHIV---------- 352
               .||    :..|.:.:.|.:||.:|: |:||:.:|...:...::||.:.|..:          
 Frog   330 ---SGT----TKTKIVAYVIAIALHISD-FQVDLTLLQSDMKLQESRILEIAKAMGLKIAKRTMY 386

  Fly   353 -NALPKSNSDILSLRLPSKV--PALKSGRRFQRKK 384
             .:|.:....|..|.:|..|  |   ||...:|||
 Frog   387 SESLIEEGHKIGMLTIPLTVYKP---SGGELKRKK 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18600NP_650708.1 RNA_pol_I_A49 33..379 CDD:284324 84/405 (21%)
polr1eNP_001120306.1 RNA_pol_I_A49 32..412 CDD:284324 83/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346946at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14440
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.