DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and DYNLT3

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_006511.1 Gene:DYNLT3 / 6990 HGNCID:11694 Length:116 Species:Homo sapiens


Alignment Length:106 Identity:51/106 - (48%)
Similarity:72/106 - (67%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQK 70
            :|..|..::....:||.::..:||..|.|:.:|.||..:||..||.|.|..|.||||||..::||
Human     9 DEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQK 73

  Fly    71 NGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            :..|.||||||:|:..:||:|||||||:||.|||:||.:|:
Human    74 SAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 49/100 (49%)
DYNLT3NP_006511.1 DLC-like_DYNLT3 16..112 CDD:412011 48/95 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4548
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.