DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and Dynlt3

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_080251.3 Gene:Dynlt3 / 67117 MGIID:1914367 Length:116 Species:Mus musculus


Alignment Length:106 Identity:49/106 - (46%)
Similarity:72/106 - (67%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQK 70
            :|..|..|:....:||.::..:|||.|..:.:|.||..:||..:|.|.|..|.||||||..::|:
Mouse     9 DEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAVVQR 73

  Fly    71 NGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            :..|.||||||:|:..:||:||:||||:||.|||:||.:|:
Mouse    74 SPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 47/100 (47%)
Dynlt3NP_080251.3 Tctex-1 17..113 CDD:281624 45/95 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4548
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.