DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and dynlt1b

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001129255.1 Gene:dynlt1b / 565740 ZFINID:ZDB-GENE-041210-9 Length:113 Species:Danio rerio


Alignment Length:113 Identity:73/113 - (64%)
Similarity:90/113 - (79%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDDSR--EESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIV 63
            |||.:  |||.||||:||..:||::|..||.|.|:|::|:.||..|.|.||..|:|..||:||||
Zfish     1 MDDDQTVEESAFIVDEVSSIVKESLEAVIGRNMYEHNRVSQWTSSVAEQCLGQLSKLGKPFKYIV 65

  Fly    64 TAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            |.:|||||||||.:||||:|:|.||||||||||||.:||||||||||:
Zfish    66 TCIIMQKNGAGLQSASSCFWDNTTDGSCTVRWENKHLYCIVSVFGLAI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 66/100 (66%)
dynlt1bNP_001129255.1 Tctex-1 16..112 CDD:281624 61/95 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575753
Domainoid 1 1.000 149 1.000 Domainoid score I4385
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4754
Inparanoid 1 1.050 161 1.000 Inparanoid score I4208
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 1 1.000 - - otm26009
orthoMCL 1 0.900 - - OOG6_101714
Panther 1 1.100 - - LDO PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5146
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.