DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and dynlt1

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001011428.1 Gene:dynlt1 / 496911 XenbaseID:XB-GENE-491829 Length:113 Species:Xenopus tropicalis


Alignment Length:113 Identity:81/113 - (71%)
Similarity:95/113 - (84%) Gaps:2/113 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDD--SREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIV 63
            ||:  :.|||.|:||::|..|||:||:.||||||||:|||.||..|||..|:.|||..||:||||
 Frog     1 MDEFQTAEESSFVVDEISNIIKESIESAIGGNAYQHNKVNQWTTNVVEQTLSQLTKLGKPFKYIV 65

  Fly    64 TAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            |.:|||||||||||||||:|:|.|||||||||||||||||||.||||:
 Frog    66 TCVIMQKNGAGLHTASSCFWDNATDGSCTVRWENKTMYCIVSAFGLAI 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 75/100 (75%)
dynlt1NP_001011428.1 Tctex-1 17..112 CDD:308957 71/94 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4116
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4754
Inparanoid 1 1.050 169 1.000 Inparanoid score I4025
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 1 1.000 - - oto103040
Panther 1 1.100 - - LDO PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5146
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.080

Return to query results.
Submit another query.