DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and CG5359

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001163579.1 Gene:CG5359 / 41222 FlyBaseID:FBgn0037773 Length:173 Species:Drosophila melanogaster


Alignment Length:97 Identity:27/97 - (27%)
Similarity:45/97 - (46%) Gaps:6/97 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TIKEAIETTIG----GNAYQHDKVNNWTGQVVENCLTVLTKEQ--KPYKYIVTAMIMQKNGAGLH 76
            |||..:...:.    ...|..|....||.::.:.....:....  |.||::|..|:.|:.|||..
  Fly    73 TIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGAT 137

  Fly    77 TASSCYWNNDTDGSCTVRWENKTMYCIVSVFG 108
            ..|.|.|:.|.|.|.:..:.|.:::|:.:|||
  Fly   138 YNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 27/97 (28%)
CG5359NP_001163579.1 Tctex-1 74..171 CDD:281624 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.