DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and CG7276

DIOPT Version :10

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster


Alignment Length:42 Identity:13/42 - (30%)
Similarity:17/42 - (40%) Gaps:8/42 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GVDSSVG-----YNTDLQSTGHEF---KSGLVPPGLLSLEID 38
            |.:|.||     |...||....|.   ::.:.|...|.|.||
  Fly   442 GSESVVGSFEQDYMGKLQQPDVEVDQSEAAMPPEDFLFLYID 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 11/37 (30%)
CG7276NP_996092.1 DLC-like_TCTEX1D2 66..169 CDD:412007
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.