DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and CG7276

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_996092.1 Gene:CG7276 / 39668 FlyBaseID:FBgn0036499 Length:171 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:44/92 - (47%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IKEAIETTIGGNAYQHDKVNNWTGQVVENC-LTVLTKEQKP-YKYIVTAMIMQKNGAGLHTASSC 81
            |.:.::..:....|...:...||.:|.::. :.:..:...| :|::|..|:.|:.|||....:..
  Fly    76 IAQVVKEKLANKTYNQSEALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARA 140

  Fly    82 YWNNDTDGSCTVRWENKTMYCIVSVFG 108
            .|:..:|...|..::..:..||.:|||
  Fly   141 IWDELSDDYITFTFDGGSFICIAAVFG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 21/92 (23%)
CG7276NP_996092.1 Tctex-1 72..169 CDD:281624 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440456
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.