DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and Dynlt3

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001013246.1 Gene:Dynlt3 / 363448 RGDID:1549755 Length:116 Species:Rattus norvegicus


Alignment Length:106 Identity:47/106 - (44%)
Similarity:70/106 - (66%) Gaps:0/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQK 70
            :|..|..::....:||.:|..:|||.|..:.:|.||..:||..:..|.|..|.||||||..::|:
  Rat     9 DEIGFNAEEAHNIVKECVEGVLGGNDYNQNSINQWTASIVEQSIAHLVKLGKAYKYIVTCAVVQR 73

  Fly    71 NGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            :..|.|.||||:|:..:||:|||||||:||.|:|:||.:|:
  Rat    74 SPYGFHVASSCFWDTTSDGTCTVRWENRTMNCVVNVFAVAI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 45/100 (45%)
Dynlt3NP_001013246.1 Tctex-1 17..113 CDD:281624 44/95 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54205
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.