DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and dlc1

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001018252.1 Gene:dlc1 / 3361491 PomBaseID:SPAC1805.08 Length:111 Species:Schizosaccharomyces pombe


Alignment Length:96 Identity:25/96 - (26%)
Similarity:48/96 - (50%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQK-----NGAGLHTASS 80
            ||.:..:..:.|..||.......|:...|..|.||.:.||:||::.::||     ...|:|.|.:
pombe    16 EAAQPVLKASEYDGDKTAEMNQSVIYAVLNALNKETQSYKWIVSSTLVQKLPEDHPSRGVHAAHA 80

  Fly    81 CYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            ..||.:.||..|::...:.:..::|:..:::
pombe    81 ACWNCEKDGMTTIKESGEAIDVVLSIMWISI 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 25/94 (27%)
dlc1NP_001018252.1 Tctex-1 9..109 CDD:281624 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3430
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2057
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 1 1.000 - - oto100863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21255
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4548
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.