DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and dylt-3

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_001317727.1 Gene:dylt-3 / 188123 WormBaseID:WBGene00011469 Length:148 Species:Caenorhabditis elegans


Alignment Length:105 Identity:26/105 - (24%)
Similarity:50/105 - (47%) Gaps:5/105 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIM 68
            |..|.|    ::...|:::.::.||...|...|:::|..::::.....|.|.....|::|...|.
 Worm    40 SNAEEQ----EIDLIIQKSFDSIIGKTPYSPFKMSDWMSKMIQTISDNLVKLNGSKKFLVHCTIS 100

  Fly    69 QK-NGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVF 107
            .| :...:.||:.|.|:...|.:....|.:||::..|.||
 Worm   101 AKTDNLAICTANMCSWDTTKDTAYYSEWMSKTIFGAVQVF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 23/99 (23%)
dylt-3NP_001317727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101714
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.