DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dlc90F and dynlt3

DIOPT Version :9

Sequence 1:NP_477356.1 Gene:Dlc90F / 42199 FlyBaseID:FBgn0024432 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_004911807.1 Gene:dynlt3 / 101732306 XenbaseID:XB-GENE-489762 Length:114 Species:Xenopus tropicalis


Alignment Length:110 Identity:58/110 - (52%)
Similarity:79/110 - (71%) Gaps:0/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAM 66
            |.::.|:.|..|:.|..:||.::..:||..|..:::|.|...|||..||.|.|..|.:||||:..
 Frog     3 DQNKGEAAFSGDEASIIVKECVDVILGGVDYDENRINEWMSAVVEQSLTHLVKMGKAFKYIVSCT 67

  Fly    67 IMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV 111
            :|||.|:|||.||||:|:|:|||||||||||:|||||||||.:|:
 Frog    68 VMQKRGSGLHAASSCFWDNNTDGSCTVRWENRTMYCIVSVFAVAI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dlc90FNP_477356.1 DLC-like_DYNLT1 10..111 CDD:412010 55/100 (55%)
dynlt3XP_004911807.1 Tctex-1 15..111 CDD:367593 53/95 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1474572at2759
OrthoFinder 1 1.000 - - FOG0002329
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.