DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7131 and Saxo1

DIOPT Version :9

Sequence 1:NP_650706.1 Gene:CG7131 / 42197 FlyBaseID:FBgn0038598 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006238435.1 Gene:Saxo1 / 679802 RGDID:1583685 Length:476 Species:Rattus norvegicus


Alignment Length:493 Identity:112/493 - (22%)
Similarity:173/493 - (35%) Gaps:134/493 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CPPCDCGDYAGCCYQQPPRTMPILPKSHFMRSTAP------LDTDTIY-----RRSFYANCGDNI 84
            |..|.||.:.  |        |.||...:.::..|      .:...||     |.||...|.   
  Rat     8 CNLCTCGRHR--C--------PHLPTKIYDKTEKPSLLSEYTENYPIYESYLPRNSFKPECA--- 59

  Fly    85 RARPVMPCSQIRASTAPLEKCTIQK----LSYMPPCPVKRTPPIVPMESGLRFEGPIYAMTSQKH 145
                      .:.::.|:|..|..:    |..|.|....:....||.:..:..      :||.||
  Rat    60 ----------YQKASIPMEGLTTSRRDFGLHKMLPVKFYQPAAYVPSQESMNL------LTSYKH 108

  Fly   146 DY-----VPKGIVKRDPIKPRVAICTSNAPMERCTIQ-----KLSYMPIDVCQNPPPKAMVQGSH 200
            |:     .|.|:     ||||    .|..|....|:|     |:.|:|    .|.|.:.:::..|
  Rat   109 DFNYIPTCPVGL-----IKPR----DSKFPNGDKTVQYLPTYKVDYVP----WNQPRRELLRPPH 160

  Fly   201 YCKP-AGPMERCTIQKLSYMPVCLPAKEPTPWADKIRCVPPRYSNVC-------TTYNLSYMPNC 257
            ..:| :...|..|..:..|...||...|        .|.|...:.:|       |.|.:||:|:.
  Rat   161 KYRPESAKFENRTTHQDDYTMKCLVTTE--------SCKPSVKAKICNIPLEDLTNYKMSYVPHP 217

  Fly   258 NEAR-----------TAPVTPLTTLR-----FCGNDAGSGS-----TVYKLSYMPVDASRTK--- 298
            .|.|           ..|...|||.:     ..|..|.|..     .|:.:.:..:...:.|   
  Rat   218 VEKRFVKEAEKYIPCDIPFENLTTHKESYRGLLGEPAKSSKPPGKIPVHDVPFSDITEIQEKYQA 282

  Fly   299 -PAP-VLPRD--TFCRPSGPLERCTIQKLSYQPNCTERTPPI--RPMENGLRFDGPMYAMTTQKH 357
             |.| ::|:.  .:..|...::..|..:..|:..  :.:|.|  ||:.: ::..|...:.||.|.
  Rat   283 WPTPQIVPKAPVVYVPPEEKMDLLTTVQTHYKHR--KGSPAITCRPVPS-IKKSGRFQSSTTSKD 344

  Fly   358 DFVAKPHVRRAPIMPRTAFCRPTGAMERCTVNKLSYMPVDVTCFPRAESVRPRQGFCRNEGPMEK 422
            ||.....|...||.|......|...::..|..|:.|:|...|.   .|:.:|.....|...|:|.
  Rat   345 DFKQWAAVNTKPIRPVPHLNLPVEPLDCQTTTKICYVPHPPTI---TENYKPAWVGPRRNIPVEG 406

  Fly   423 CTTYKLSYLP----NCVPPKEPLPWARYTSYCRPTGPI 456
            .|||.:|:.|    .|.           .||..|.|.|
  Rat   407 QTTYSISFTPKDLGRCP-----------ASYINPPGYI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7131NP_650706.1 None
Saxo1XP_006238435.1 STOP 5..218 CDD:283000 59/259 (23%)
STOP <298..430 CDD:283000 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339335
Domainoid 1 1.000 64 1.000 Domainoid score I9889
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D193131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31516
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2574
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.