DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7131 and H13N06.7

DIOPT Version :9

Sequence 1:NP_650706.1 Gene:CG7131 / 42197 FlyBaseID:FBgn0038598 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001024737.2 Gene:H13N06.7 / 3565212 WormBaseID:WBGene00044142 Length:217 Species:Caenorhabditis elegans


Alignment Length:191 Identity:44/191 - (23%)
Similarity:65/191 - (34%) Gaps:74/191 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 PRYSNVCTTYNLSY---MPNCNEAR--------TAPVTPLTTLRFCGNDAGSGSTVYKLSYMPVD 293
            |.|..  ||.|.:|   :|:..|.|        .||..|..:           .|.::..|.|.|
 Worm    65 PFYGR--TTNNAAYTWKVPHAREKREITESETGDAPKIPFYS-----------ETTHRSQYQPFD 116

  Fly   294 AS--RTK--------PAPVLPRDT------------FCRPSGPLERCTIQKLSYQPNCTERTPPI 336
            ||  ||:        |...:|.||            ..:....::.|..:||.:|   |.....|
 Worm   117 ASVARTRLSRKASALPVSNVPLDTQTTYRNLFQELEIGKRQKLIQTCPAEKLIHQ---TALLRSI 178

  Fly   337 RPMENGLRFDGPMYAMTTQKHDFVAKPHVRRAPIMPRTAFCRPTGAMERCTVNKLSYMPVD 397
            | .|||              |.|::...:|.:..: ||....||         :.|.:||:
 Worm   179 R-RENG--------------HYFLSAEALRSSKYV-RTTAAAPT---------QPSTLPVE 214



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.