DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7131 and T08G11.3

DIOPT Version :9

Sequence 1:NP_650706.1 Gene:CG7131 / 42197 FlyBaseID:FBgn0038598 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_492403.2 Gene:T08G11.3 / 188307 WormBaseID:WBGene00011630 Length:580 Species:Caenorhabditis elegans


Alignment Length:298 Identity:66/298 - (22%)
Similarity:89/298 - (29%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 TTYNLSY----MPNCNEARTAPVTPLTTLRFCGNDAGSGSTVYKLSYMPVDASRTKPAPVL---P 304
            |.|.:.|    .|...:|::...|      |..:....|:|:.:..|.....:|..|...:   |
 Worm    39 TEYGMQYPAKQAPRERQAKSRNAT------FLSDGDFDGTTINRQDYGEKKVARNAPFKFVNTGP 97

  Fly   305 RDTFCRPSGPLERCTIQKLSYQPNCTERTPPIRPMENGLR------------------------- 344
            .|     ||.....|.|::.:|.....|..|:||..|||:                         
 Worm    98 LD-----SGEFLADTTQRVDFQGKSINRQAPLRPTTNGLQSGEFEGYTTHKSDFDYKGDPRTGVI 157

  Fly   345 --------FDGPMYAMTTQKHDFVAKPHVRRAPIMPRTAFCRPTGAMERCTVNKLSYMPVDVTCF 401
                    |.||..:.||.:.||..|...|...:...|:.....|.....|.||..|        
 Worm   158 RGPQDAQLFSGPFNSTTTNRADFDKKQAERSGILRGPTSTNMFGGQFNGTTTNKTDY-------- 214

  Fly   402 PRAESVRPRQGFCRN-------EGPMEKCTTYKLSYLPNCVPPKEPLPWARYTSYCR-PT----- 453
              .:....|.|..|.       .||....||.|..|     ..|:    |..:...| ||     
 Worm   215 --DQKQAERNGIIRGAADAQLFSGPFNGQTTNKSDY-----DQKQ----AERSGILRGPTNTEMF 268

  Fly   454 -GPIEKCTIQKLSYGPP--GAFQRCGGPCGTGANDGTF 488
             ||....|..|..|...  |..:...||..|....|.|
 Worm   269 SGPFNGQTTNKSDYDQKQVGRSEILKGPANTEMFSGPF 306



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D193131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31516
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4140
SonicParanoid 1 1.000 - - X2574
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.