DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and TMPRSS5

DIOPT Version :10

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:256 Identity:73/256 - (28%)
Similarity:120/256 - (46%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSH 143
            :.:..:...|...|:..|:.:     |..|.|.|:::...|::|||||:.|.:....|     |.
Human   217 RIVGGQSVAPGRWPWQASVAL-----GFRHTCGGSVLAPRWVVTAAHCMHSFRLARLS-----SW 271

  Fly   144 DIHDQKGEASNIQMR-H----IDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDA 203
            .:|  .|..|:..:| |    ::..:.|.||....:.||:||:..:..|.|...|....||.::.
Human   272 RVH--AGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQ 334

  Fly   204 Q-PEGYGT-LYGWGNVSMTAVPNYPH---RLQEANMPILDMELCEQILARSGLPLHETNLCTGPL 263
            . |:|... :.|||:..    |::.:   .||:..:|:...:||......|| .|....||.|.|
Human   335 HFPKGSRCWVSGWGHTH----PSHTYSSDMLQDTVVPLFSTQLCNSSCVYSG-ALTPRMLCAGYL 394

  Fly   264 TGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWIN 324
            .|....|..||||||:   |.:  .....::|:||||: .|.:.|.|.|:.:|:.|.:||:
Human   395 DGRADACQGDSGGPLV---CPD--GDTWRLVGVVSWGR-GCAEPNHPGVYAKVAEFLDWIH 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/251 (29%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:464747
Tryp_SPc 217..448 CDD:214473 71/253 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.