DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Tmprss5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001346389.1 Gene:Tmprss5 / 80893 MGIID:1933407 Length:455 Species:Mus musculus


Alignment Length:324 Identity:88/324 - (27%)
Similarity:140/324 - (43%) Gaps:68/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LSSASSGSIQ---LPTVRKCGGGRSAGAAHTMAMNLAAYGL--LENRISTLEAPRQTHWTKKFLA 82
            ||:...|.::   .|:. .|..||      .:::..:..|.  |.:||...:|.....|      
Mouse   178 LSARPGGLVEESWKPSA-NCPSGR------IVSLKCSECGARPLASRIVGGQAVASGRW------ 229

  Fly    83 KREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSV--IVAG--SH 143
                     |:..|:.:     |..|.|..:::..||::|||||:.|.:....|.  :.||  ||
Mouse   230 ---------PWQASVML-----GSRHTCGASVLAPHWVVTAAHCMYSFRLSRLSSWRVHAGLVSH 280

  Fly   144 DIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGY 208
                  |.....|...::..:.|.||....:.||:||:..:.|:.|...|....||.:: |...:
Mouse   281 ------GAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINFSDTVGAVCLPAKE-QHFPW 338

  Fly   209 GT---LYGWGNVSMTAVPNYPH---RLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGV 267
            |:   :.|||:..    |::.|   .||:..:|:|...||......||...|.. ||.|.|.|..
Mouse   339 GSQCWVSGWGHTD----PSHTHSSDTLQDTMVPLLSTYLCNSSCMYSGALTHRM-LCAGYLDGRA 398

  Fly   268 SICTADSGGPLIQQCCEE----HFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ..|..||||||:   |..    |      ::|:||||: .|.:.|.|.|:.:|:.|.:||:..:
Mouse   399 DACQGDSGGPLV---CPSGDTWH------LVGVVSWGR-GCAEPNRPGVYAKVAEFLDWIHDTV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/255 (29%)
Tryp_SPc 84..323 CDD:214473 73/252 (29%)
Tmprss5NP_001346389.1 SRCR_2 116..213 CDD:317845 8/41 (20%)
Tryp_SPc 217..448 CDD:214473 77/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.