DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and zgc:153968

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:326 Identity:94/326 - (28%)
Similarity:134/326 - (41%) Gaps:70/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CIYSVLLSTIASIMVVLSSASSGSI-QLPTVRKCGGGRSAGAAHTMAMNLAAYGLLENRISTLEA 70
            |:..|||..|           |||: ||..   ||                            .|
Zfish     8 CVAGVLLLNI-----------SGSLCQLDV---CG----------------------------RA 30

  Fly    71 PRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVEN 135
            |.:    .:.:..:.|...|.|:.|||..: |..||:  |.||:||..|:|:||.|.....| .|
Zfish    31 PLK----PRIIGGQTAMAGSWPWQVSIHYI-PTGGLL--CGGTLINREWVLSAAQCFQKLTA-SN 87

  Fly   136 SVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPE 200
            .|:..|    |...|: .|:........:.|..|....|..||||:....|:.|..|::|..|..
Zfish    88 LVVHLG----HLSTGD-PNVIHNPASQIINHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTA 147

  Fly   201 QDAQPEGYGT---LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGP 262
            ..:. .|.|.   :.|||::: |....:|..|||..:|::....|:   :..|..:.:..:|.||
Zfish   148 SGSS-LGKGAVSWITGWGSIN-TGGTQFPTTLQEVKIPVVSNGDCK---SAYGSLITDGMICAGP 207

  Fly   263 LTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327
            ..||..||..|.||||:....|:..:.     ||.|:|: .|.|...|.||.|||.:..||...|
Zfish   208 NEGGKGICMGDGGGPLVHNSSEQWIQS-----GIASFGR-GCAQPKNPGVFTRVSEYESWIKSQI 266

  Fly   328 S 328
            |
Zfish   267 S 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 78/244 (32%)
Tryp_SPc 84..323 CDD:214473 76/241 (32%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 76/246 (31%)
Tryp_SPc 36..265 CDD:238113 78/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.