DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Prss44

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:287 Identity:84/287 - (29%)
Similarity:128/287 - (44%) Gaps:45/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 STLEAPRQT------------HWTKKFLAKREATPHSAPYVVSIQMMTPDQGLVHYCAGTIINEH 118
            ||:...||.            |.|.:.:..|.|.....|:.||:|:...     |.|.|::|::.
Mouse    86 STMSLSRQPFPTWVPPTSACGHRTARIVGGRPAPARKWPWQVSLQVHKQ-----HICGGSLISKW 145

  Fly   119 WILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYT 183
            |::|||||:....   :..:..|..|:..::.....:|    |..|..:..:.....:||||:..
Mouse   146 WVITAAHCVYGHL---DYAVFMGDADLWSKRPVRIPVQ----DIIVHQDFSMMRTVVHDIALVLL 203

  Fly   184 KEPLVFDTYVQPATLPEQD--AQPEGYGTL---YGWGNVSMTAVPNYPHRLQEANMPILDMELCE 243
            ..|:.:...:||..:||:.  .||   |||   .|||.|....  .....|||..:.|:..|.|.
Mouse   204 AFPVNYSVNIQPVCIPEKSFLVQP---GTLCWVTGWGKVLEQG--RSSRILQEIELNIIRHEKCN 263

  Fly   244 QIL----ARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPC 304
            |||    ......:.|..:|.....|| ..|..||||||:   ||  |.:..:.:|||||| :.|
Mouse   264 QILKDIMGNIFTLVQEGGVCGYNEKGG-DACQGDSGGPLV---CE--FNKTWVQVGIVSWG-LGC 321

  Fly   305 GQKNAPSVFVRVSAFTEWINQVISTAT 331
            |:...|.|:..||.:.:||.:.:|.|:
Mouse   322 GRIGYPGVYTEVSYYRDWIIKELSRAS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 76/250 (30%)
Tryp_SPc 84..323 CDD:214473 74/247 (30%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 74/252 (29%)
Tryp_SPc 112..340 CDD:238113 74/251 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.