DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7142 and Klk5

DIOPT Version :9

Sequence 1:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_081082.1 Gene:Klk5 / 68668 MGIID:1915918 Length:293 Species:Mus musculus


Alignment Length:240 Identity:62/240 - (25%)
Similarity:97/240 - (40%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YCAGTIINEHWILTAAHCLS------------SPQAVENSVIVAG----SHDIHDQKGEASNIQM 157
            ||...:|:..|:||||||..            ||.......:..|    .|..:...|.::::.:
Mouse    93 YCGAVLISPQWLLTAAHCRKPVFRIRLGHHSMSPVYESGQQMFQGIKSIPHPGYSHPGHSNDLML 157

  Fly   158 RHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLY-GWGNVSMTA 221
            ..::..:|..   ..|.|.:||.                     |...||...:. |||..| ::
Mouse   158 IKMNRKIRDS---HSVKPVEIAC---------------------DCATEGTRCMVSGWGTTS-SS 197

  Fly   222 VPNYPHRLQEANMPILDMELCEQILARSGLP--LHETNLCTGPLTGGVSICTADSGGPLIQQCCE 284
            ..|:|..||..|:.:|..|.|     ::..|  :.:|..|.|...|..| |..|||||::   |.
Mouse   198 HNNFPKVLQCLNITVLSEERC-----KNSYPGQIDKTMFCAGDEEGRDS-CQGDSGGPVV---CN 253

  Fly   285 EHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVIST 329
            ...:      |:||||..||.|:|.|.|:..:..|.:||...:::
Mouse   254 GKLQ------GLVSWGDFPCAQRNRPGVYTNLCEFVKWIKDTMNS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 62/235 (26%)
Tryp_SPc 84..323 CDD:214473 60/232 (26%)
Klk5NP_081082.1 Tryp_SPc 67..286 CDD:214473 60/232 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.